ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-11 15:13:01, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_074736329 538 bp mRNA linear PLN 25-JUN-2025
DEFINITION PREDICTED: Curcuma longa uncharacterized LOC141848280
(LOC141848280), transcript variant X1, mRNA.
ACCESSION XM_074736329
VERSION XM_074736329.1
DBLINK BioProject: PRJNA1277305
KEYWORDS RefSeq.
SOURCE Curcuma longa (turmeric)
ORGANISM Curcuma longa
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliopsida; Liliopsida; Zingiberales;
Zingiberaceae; Curcuma.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_133877) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_044706935.1-RS_2025_06
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.4
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 06/19/2025
##Genome-Annotation-Data-END##
FEATURES Location/Qualifiers
source 1..538
/organism="Curcuma longa"
/mol_type="mRNA"
/cultivar="G26"
/db_xref="taxon:136217"
/chromosome="17"
/tissue_type="leaves"
/ecotype="Majalengka, Jawa Barat"
/geo_loc_name="Indonesia"
/lat_lon="6.9163 S 107.7713 E"
/collection_date="2023-08-23"
/collected_by="Institut Teknologi Bandung"
/genotype="G26"
gene 1..538
/gene="LOC141848280"
/note="uncharacterized LOC141848280; Derived by automated
computational analysis using gene prediction method:
Gnomon. Supporting evidence includes similarity to: 100%
coverage of the annotated genomic feature by RNAseq
alignments, including 1 sample with support for all
annotated introns"
/db_xref="GeneID:141848280"
CDS 77..451
/gene="LOC141848280"
/codon_start=1
/product="uncharacterized protein LOC141848280"
/protein_id="XP_074592430.1"
/db_xref="GeneID:141848280"
/translation="
MGSLSRTYKVAGTSSTTSPVVTSQIHSLTEEVTHLKGLLEQRDQEMIRRDEEMKKRDNEIKKLQRQQSRILQHFQLQSLLGDDDDDDDDHDDASDDGGFCKQIKKKRRIKDSDEESSRVSGGPR"
misc_feature <143..>271
/gene="LOC141848280"
/note="Possible nuclease of RNase H fold, RuvC/YqgF family
[General function prediction only]; Region: COG2433"
/db_xref="CDD:441980"
ORIGIN
gccctcagttggcaatgaattgagtctgtggttggaggcgagtgggggatgcaaagggggtggaaggattttgggtatgggttctttgagcagaacctataaagttgctggtacctcttccaccacctcccctgttgtcacatcacagattcatagtttgactgaggaggtaacccatttgaaagggttattagaacaaagagatcaagaaatgataagaagagatgaagaaatgaaaaaaagagataatgaaattaaaaaattgcaaagacaacaatctcgcatcttgcaacattttcagttgcaatctcttcttggtgacgacgacgacgacgacgacgaccacgatgacgccagtgacgatggtggtttttgtaaacaaatcaaaaaaaaaaggcgaataaaagatagtgacgaagaatccagtagagtttctgggggaccacgatgatcttcttcctatcttttattcatatctcatctgatttgtttagactttgtatggattagttggatttttctgatactttgactttgt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]