ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-29 00:40:44, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_067886343 549 bp mRNA linear PLN 29-AUG-2024 DEFINITION Phytophthora ramorum Protein argonaute-4 (KRP23_1681), partial mRNA. ACCESSION XM_067886343 VERSION XM_067886343.1 DBLINK BioProject: PRJNA1149793 BioSample: SAMN19730089 KEYWORDS RefSeq. SOURCE Phytophthora ramorum (sudden oak death agent) ORGANISM Phytophthora ramorum Eukaryota; Sar; Stramenopiles; Oomycota; Peronosporomycetes; Peronosporales; Peronosporaceae; Phytophthora. REFERENCE 1 (bases 1 to 549) AUTHORS Carleson,N.C., Press,C.M. and Grunwald,N.J. TITLE High-Quality, Phased Genomes of Phytophthora ramorum Clonal Lineages NA1 and EU1 JOURNAL Mol Plant Microbe Interact 35 (4), 360-363 (2022) PUBMED 35285670 REFERENCE 2 (bases 1 to 549) CONSRTM NCBI Genome Project TITLE Direct Submission JOURNAL Submitted (27-AUG-2024) National Center for Biotechnology Information, NIH, Bethesda, MD 20894, USA REFERENCE 3 (bases 1 to 549) AUTHORS Carleson,N.C., Press,C.M. and Grunwald,N.J. TITLE Direct Submission JOURNAL Submitted (19-JUL-2021) Horticultural Crops Research Unit, USDA, 3420 NW Orchard Ave., Corvallis, OR 97330, USA COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final NCBI review. This record is derived from an annotated genomic sequence (NW_027150648). COMPLETENESS: incomplete on both ends. FEATURES Location/Qualifiers source 1..549 /organism="Phytophthora ramorum" /mol_type="mRNA" /isolate="Pr-102" /host="Quercus agrifolia" /db_xref="taxon:164328" /chromosome="Unknown" /mating_type="A2" /geo_loc_name="USA: California" /collection_date="2004" /genotype="NA1" gene <1..>549 /locus_tag="KRP23_1681" /db_xref="GeneID:94222150" CDS 1..549 /locus_tag="KRP23_1681" /codon_start=1 /product="Protein argonaute-4" /protein_id="XP_067749014.1" /db_xref="GeneID:94222150" /translation="
MDAIDFLCETLALRNMSTSVAKYQHSTFSKAIRDVKVNMIHRPGVKRSYRVNGLSRESADNTFFGDDEGQRMSIAQYFQQTYKIRLRYQKLSCLQRNYLPMEVCHVMAGQTCLHNVTDTQVANMIRLTCTPPGDRSSTSSARLTSTRTRSPKASTGCGKAENGGNDGPPAATSCDRVQWRGL"
misc_feature 1..318
/locus_tag="KRP23_1681"
/note="PAZ domain, argonaute_like subfamily. Argonaute is
part of the RNA-induced silencing complex (RISC), and is
an endonuclease that plays a key role in the RNA
interference pathway. The PAZ domain has been named after
the proteins Piwi,Argonaut, and Zwille; Region:
PAZ_argonaute_like; cd02846"
/db_xref="CDD:239212"
misc_feature order(145..147,187..189,220..222,232..234,289..291,
295..297)
/locus_tag="KRP23_1681"
/note="nucleic acid-binding interface [nucleotide
binding]; other site"
/db_xref="CDD:239212"
ORIGIN
atggacgcgatagactttctgtgcgagacgctggcgctcaggaacatgtccacgtctgtggctaagtaccagcactcgaccttcagcaaggccattcgagacgtcaaagtcaacatgatccatcgtccaggggtcaagcgcagctaccgtgtgaacggcttgtcacgtgaaagcgcagataatacgttcttcggggacgacgaagggcagcgcatgtccatcgctcagtacttccagcaaacgtacaaaatccgtctgcgctaccagaagctatcgtgtttgcagaggaattacttgcctatggaggtctgtcacgtcatggcgggtcagacgtgtcttcacaatgtcacggacacgcaggtggccaacatgatccgcctcacgtgcacgcctcccggcgatcgctcgagcacaagctccgcgaggctgacttcaacacggacccgatcccccaaggcgtcgactggatgtggtaaagccgagaatggtggaaacgacgggccgccagctgccacctcctgcgatcgagtacagtggaggggcttgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]