GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-29 00:40:53, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_043328844             567 bp    mRNA    linear   PLN 27-AUG-2021
DEFINITION  Rhizoctonia solani Lytic polysaccharide mono-oxygenase,
            cellulose-degrading (RhiXN_09028), partial mRNA.
ACCESSION   XM_043328844
VERSION     XM_043328844.1
DBLINK      BioProject: PRJNA727464
            BioSample: SAMN14572378
KEYWORDS    RefSeq.
SOURCE      Rhizoctonia solani
  ORGANISM  Rhizoctonia solani
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Cantharellales; Ceratobasidiaceae; Rhizoctonia.
REFERENCE   1  (bases 1 to 567)
  AUTHORS   Li,C. and Chen,X.
  TITLE     Evolutionary and genomic comparisons of hybrid uninucleate and
            nonhybrid Rhizoctonia fungi
  JOURNAL   Unpublished
REFERENCE   2  (bases 1 to 567)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (27-AUG-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 567)
  AUTHORS   Li,C. and Chen,X.
  TITLE     Direct Submission
  JOURNAL   Submitted (18-MAY-2020) Department of Plant Pathology, China
            Agricultural University, Yuanmingyuan Xilu 2, Beijing 100193, China
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_057374).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..567
                     /organism="Rhizoctonia solani"
                     /mol_type="mRNA"
                     /strain="AG-1 IA"
                     /isolate="XN"
                     /isolation_source="maize"
                     /db_xref="taxon:456999"
                     /chromosome="5"
                     /collection_date="2014"
                     /collected_by="CAU"
     gene            <1..>567
                     /locus_tag="RhiXN_09028"
                     /db_xref="GeneID:67031307"
     CDS             1..567
                     /locus_tag="RhiXN_09028"
                     /codon_start=1
                     /product="Lytic polysaccharide mono-oxygenase,
                     cellulose-degrading"
                     /protein_id="XP_043180290.1"
                     /db_xref="GeneID:67031307"
                     /translation="
MRFLAGLLTLATLASSVVAHGIVTQPPTRTLGSAMIAACGEGAVSAQKSNVKGPIESQIAKIDSNYKPAQCNLFLCRGQQFADNKDKVQTYKTGQVVNIVLDIENHHPVGYANVSVIDTATNKMVGKPLIAWDPYFTGYPYPKDQENFNVTIPELSGKCKTAGECVLQYHWYSRTDRQTYQNCVDFVV"
     misc_feature    58..558
                     /locus_tag="RhiXN_09028"
                     /note="Lytic polysaccharide mono-oxygenase,
                     cellulose-degrading; Region: LPMO_10; pfam03067"
                     /db_xref="CDD:460793"
ORIGIN      
atgcgcttcctggctggtttattgactttggcgactttggcgtcgtccgttgtcgctcatggcattgtaactcaacctccaactcgcacactcgggagtgccatgattgcagcttgcggtgaaggtgctgtctcggctcaaaaatccaatgtcaagggaccgattgaaagccagattgccaagattgattccaactacaagcccgcgcaatgcaatctcttcttgtgccgtggccaacagtttgctgacaacaaggacaaagtccaaacctacaagactggtcaagtcgtgaacattgtactagacattgagaaccaccatcctgttggctatgcaaacgtatctgttatcgatactgccacaaacaagatggttggcaagcctctgattgcatgggatccttactttactggttatccgtaccctaaggatcaagagaacttcaacgtcactattccagagctcagcggcaaatgcaagactgccggagaatgtgttctacaataccactggtactcccgaacggacaggcagacttaccaaaactgcgtagatttcgttgtttga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]