LOCUS       XM_041430549             360 bp    mRNA    linear   PLN 15-SEP-2021
DEFINITION  Suillus discolor ABC transporter (F5147DRAFT_558639), partial mRNA.
ACCESSION   XM_041430549
VERSION     XM_041430549.1
DBLINK      BioProject: PRJNA727289
            BioSample: SAMN12812516
KEYWORDS    RefSeq.
SOURCE      Suillus discolor
  ORGANISM  Suillus discolor
            Eukaryota; Fungi; Dikarya; Basidiomycota; Agaricomycotina;
            Agaricomycetes; Agaricomycetidae; Boletales; Suillineae;
            Suillaceae; Suillus.
REFERENCE   1  (bases 1 to 360)
  AUTHORS   Lofgren,L.A., Nguyen,N.H., Vilgalys,R., Ruytinx,J., Liao,H.L.,
            Branco,S., Kuo,A., LaButti,K., Lipzen,A., Andreopoulos,W.,
            Pangilinan,J., Riley,R., Hundley,H., Na,H., Barry,K.,
            Grigoriev,I.V., Stajich,J.E. and Kennedy,P.G.
  TITLE     Comparative genomics reveals dynamic genome evolution in host
            specialist ectomycorrhizal fungi
  JOURNAL   New Phytol (2020) In press
   PUBMED   33355923
  REMARK    Publication Status: Available-Online prior to print
REFERENCE   2  (bases 1 to 360)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-SEP-2021) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 360)
  AUTHORS   Kuo,A., Lofgren,L.A., Vilgalys,R., Nguyen,N.H., Ruytinx,J.,
            Liao,H.-L., Branco,S., LaButti,K., Lipzen,A., Andreopoulos,W.,
            Pangilinan,J., Riley,R., Hundley,H., Na,H., Grigoriev,I., Barry,K.,
            Stajich,J.E. and Kennedy,P.G.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (22-APR-2020) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_024541351).
            
            ##Metadata-START##
            Organism Display Name :: Suillus discolor FC423 v1.0
            GOLD Stamp ID         :: Gp0305074
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..360
                     /organism="Suillus discolor"
                     /mol_type="mRNA"
                     /strain="FC423"
                     /db_xref="taxon:1912936"
                     /chromosome="Unknown"
     gene            <1..>360
                     /locus_tag="F5147DRAFT_558639"
                     /db_xref="GeneID:64692808"
     CDS             <1..>360
                     /locus_tag="F5147DRAFT_558639"
                     /codon_start=1
                     /product="ABC transporter"
                     /protein_id="XP_041286207.1"
                     /db_xref="GeneID:64692808"
                     /db_xref="InterPro:IPR003439"
                     /db_xref="JGIDB:Suidis1_558639"
                     /translation="

IYVALVSSSGCSKSTVIQSLECFYDPISGQISLDGELIDEFNVQAYRQQLSLVSQEPNLYAGTIHFNILLGASIPESEVTQEEIEAACCDANILDFIQSLPDGFNTEVGGKGSQLLGGQK"

     misc_feature    7..>360
                     /locus_tag="F5147DRAFT_558639"
                     /note="Members of the P-loop NTPase domain superfamily are
                     characterized by a conserved nucleotide phosphate-binding
                     motif, also referred to as the Walker A motif
                     (GxxxxGK[S/T], where x is any residue), and the Walker B
                     motif (hhhh[D/E], where h is a...; Region: P-loop
                     containing Nucleoside Triphosphate Hydrolases; cl38936"
                     /db_xref="CDD:476819"
     misc_feature    19..42
                     /locus_tag="F5147DRAFT_558639"
                     /note="Walker A/P-loop; other site"
                     /db_xref="CDD:213216"
     misc_feature    154..165
                     /locus_tag="F5147DRAFT_558639"
                     /note="Q-loop/lid; other site"
                     /db_xref="CDD:213216"
ORIGIN      

atttatgttgccttagtcagctctagtggttgcagtaaaagtacagtcatccagtcactagagtgtttctacgatccaatttctggacagatttcactcgacggagagcttatcgacgagtttaacgtccaggcatatcgacagcagctttcacttgtgtcgcaagagcctaatttgtacgcgggaactatccacttcaatatcttgctcggtgcctccataccggaatctgaggtcacacaagaagagattgaggccgcttgttgtgatgctaatatactagattttattcaatcacttccagatggatttaatactgaagtcggtggcaagggatcccagcttttggggggtcaaaaa

//