LOCUS       XM_033826478             528 bp    mRNA    linear   PLN 27-APR-2020
DEFINITION  Trematosphaeria pertusa uncharacterized protein (BU26DRAFT_500137),
            partial mRNA.
ACCESSION   XM_033826478
VERSION     XM_033826478.1
DBLINK      BioProject: PRJNA625778
            BioSample: SAMN05660896
KEYWORDS    RefSeq.
SOURCE      Trematosphaeria pertusa
  ORGANISM  Trematosphaeria pertusa
            Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
            Dothideomycetes; Pleosporomycetidae; Pleosporales; Massarineae;
            Trematosphaeriaceae; Trematosphaeria.
REFERENCE   1  (bases 1 to 528)
  AUTHORS   Haridas,S., Albert,R., Binder,M., Bloem,J., Labutti,K., Salamov,A.,
            Andreopoulos,B., Baker,S., Barry,K., Bills,G., Bluhm,B., Cannon,C.,
            Castanera,R., Culley,D., Daum,C., Ezra,D., Gonzalez,J.,
            Henrissat,B., Kuo,A., Liang,C., Lipzen,A., Lutzoni,F., Magnuson,J.,
            Mondo,S., Nolan,M., Ohm,R., Pangilinan,J., Park,H.-J., Ramirez,L.,
            Alfaro,M., Sun,H., Tritt,A., Yoshinaga,Y., Zwiers,L.-H.,
            Turgeon,B., Goodwin,S., Spatafora,J., Crous,P. and Grigoriev,I.
  TITLE     101 Dothideomycetes genomes: a test case for predicting lifestyles
            and emergence of pathogens
  JOURNAL   Stud. Mycol. (2020) In press
  REMARK    DOI: 10.1016/j.simyco.2020.01.003
REFERENCE   2  (bases 1 to 528)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (23-APR-2020) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 528)
  AUTHORS   Haridas,S., Albert,R., Binder,M., Bloem,J., Labutti,K., Salamov,A.,
            Andreopoulos,B., Baker,S.E., Barry,K., Bills,G., Bluhm,B.H.,
            Cannon,C., Castanera,R., Culley,D.E., Daum,C., Ezra,D.,
            Gonzalez,J.B., Henrissat,B., Kuo,A., Liang,C., Lipzen,A.,
            Lutzoni,F., Magnuson,J., Mondo,S., Nolan,M., Ohm,R., Pangilinan,J.,
            Park,H.-J., Ramirez,L., Alfaro,M., Sun,H., Tritt,A., Yoshinaga,Y.,
            Zwiers,L.-H., Turgeon,B.G., Goodwin,S.B., Spatafora,J.W.,
            Crous,P.W. and Grigoriev,I.V.
  CONSRTM   DOE Joint Genome Institute
  TITLE     Direct Submission
  JOURNAL   Submitted (27-JAN-2020) DOE Joint Genome Institute, 2800 Mitchell
            Drive, Walnut Creek, CA 94598-1698, USA
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NW_022987213).
            
            ##Metadata-START##
            Organism Display Name :: Trematosphaeria pertusa CBS 122368
            GOLD Stamp ID         :: Gp0036292
            ##Metadata-END##
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..528
                     /organism="Trematosphaeria pertusa"
                     /mol_type="mRNA"
                     /strain="CBS 122368"
                     /culture_collection="CBS:122368"
                     /type_material="culture from epitype of Trematosphaeria
                     pertusa"
                     /db_xref="taxon:390896"
                     /chromosome="Unknown"
     gene            <1..>528
                     /locus_tag="BU26DRAFT_500137"
                     /db_xref="GeneID:54579808"
     CDS             1..528
                     /locus_tag="BU26DRAFT_500137"
                     /codon_start=1
                     /product="uncharacterized protein"
                     /protein_id="XP_033689370.1"
                     /db_xref="GeneID:54579808"
                     /db_xref="JGIDB:Trepe1_500137"
                     /translation="

MTDTADFEQFCLTTLYNAIPMLDNPSDRYEWNNRVCDFIEISSVAEDGAPPPNKDQAKEWYRRQKLYTAMIMKKLSHNAAPRIKALGISDVQSLLEAVRERFNFSRLKDEAIEEEYRSGQRGNEPAKAQRVSNQIQTLTRQILISPDETRCQIHIDKVPFCSFCPTKLAQQPRNI"

ORIGIN      

atgaccgacaccgcggactttgagcaattttgcttaactacactctacaatgctattccgatgctcgacaaccccagcgaccggtacgagtggaataatagggtgtgcgattttattgagatttcctctgtcgccgaagatggtgctcctccaccaaacaaagatcaggcaaaggaatggtatcgccgacagaaactctacacagccatgatcatgaagaagctgtcgcacaacgctgcgccgcgaattaaggccttagggatcagtgacgtgcaatctcttcttgaagctgtgcgagagcgcttcaactttagccgcctcaaggacgaggcaatcgaggaagagtaccgatccggccagcggggcaatgagccggcgaaggcgcagcgtgttagcaaccagattcaaactcttacccgccagatattgatatcaccggacgaaaccagatgccagattcacatagacaaggttccgttttgctcattttgtcccaccaaactcgcacagcaacccagaaacatttag

//