LOCUS       XM_014549030            1157 bp    mRNA    linear   MAM 04-NOV-2015
DEFINITION  PREDICTED: Myotis brandtii protein argonaute-2-like (LOC106728082),
            mRNA.
ACCESSION   XM_014549030
VERSION     XM_014549030.1
DBLINK      BioProject: PRJNA218631
KEYWORDS    RefSeq; corrected model.
SOURCE      Myotis brandtii (Brandt's bat)
  ORGANISM  Myotis brandtii
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Laurasiatheria; Chiroptera; Yangochiroptera;
            Vespertilionidae; Myotis.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_005369955.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Myotis brandtii Annotation Release
                                           101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            internal stop codons :: corrected 1 genomic stop codon
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1157
                     /organism="Myotis brandtii"
                     /mol_type="mRNA"
                     /db_xref="taxon:109478"
                     /chromosome="Unknown"
                     /sex="male"
                     /geo_loc_name="Russia: Perm poKrai"
                     /lat_lon="58.8348 N 57.6119 E"
                     /collection_date="Dec-2011"
                     /note="collected at hibernation roost"
     gene            1..1157
                     /gene="LOC106728082"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 99% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     15 samples with support for all annotated introns"
                     /db_xref="GeneID:106728082"
     CDS             176..997
                     /gene="LOC106728082"
                     /note="The sequence of the model RefSeq protein was
                     modified relative to its source genomic sequence to
                     represent the inferred CDS: substituted 1 base at 1
                     genomic stop codon"
                     /codon_start=1
                     /transl_except=(pos:743..745,aa:OTHER)
                     /product="LOW QUALITY PROTEIN: protein argonaute-2-like"
                     /protein_id="XP_014404516.1"
                     /db_xref="GeneID:106728082"
                     /translation="

MTCALGPQVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASNQTXRLPRPVALPPGRGPVGTVTPGKRIQSVLKLAQGSQTSQWKEPGGSRQPPRCVEQGPLCPELGAEHAGSSGLLSLPQFLGVAPS"

     misc_feature    <221..361
                     /gene="LOC106728082"
                     /note="N-terminal domain of argonaute; Region: ArgoN;
                     pfam16486"
                     /db_xref="CDD:465134"
     misc_feature    389..541
                     /gene="LOC106728082"
                     /note="Argonaute linker 1 domain; Region: ArgoL1;
                     pfam08699"
                     /db_xref="CDD:462567"
     misc_feature    542..>742
                     /gene="LOC106728082"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
ORIGIN      

tttctcttcgcgactcgggccctgcagagctcgccgccggttgtttccgtgggggacagaactcccagggcccccgcaggccgccctgcctcttccggggacgcgctcctcagaggagccgacccgaccccgggctacgcgtgaccccctctgacgtggggtgggggccgcgtggatgacctgcgctctgggcccccaggtggagctggaggtcacgctgccgggcgaagggaaggaccgcatcttcaaggtgtccatcaagtgggtgtcctgcgtgagcttgcaggcgttacacgatgcactttcggggcggctgcccagcgtccccttcgagacgatccaggccctcgacgtggtcatgaggcacctgccgtccatgaggtacacgcccgtgggccgctcctttttcaccgcctccgagggctgctccaaccccctgggcggcggccgggaagtgtggttcggcttccatcagtccgtccgcccttctctttggaaaatgatgctaaatattgatgtctcggcaacggcgttctacaaggcacagccagtcatcgagtttgtttgtgaagttttggattttaaaagtattgaagaacaacaaaaacctctgacagattcccaaagggtcaagtttaccaaagaaatcaaaggtctgaaggtggagatcactcactgtgggcagatgaagaggaagtaccgcgtctgcaacgtgacccggcggccggccagcaaccaaacgtaacggctcccccggcccgtggccctcccgccaggcaggggcccagtggggacagtgactccgggaaaaaggatccagtcggttttgaaattagcccagggttcccaaacctcccagtggaaggaacctgggggctcccgccagcccccccgctgtgtagagcaggggcccctctgtcccgagcttggggctgagcatgctgggagcagcgggctgctctccctcccccagttcctgggcgtggccccgtcttagctgtgaggggccctggcttcacttaccagccggatccagggccctgaagtgactgccaggctgcagggtgggcaccgtcctggggagaagcagtaggtgcgcccccctctcctccgcatggtctcctggcccagagggtgtggggcactggtcccgcacc

//