ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-09-29 00:40:36, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_014549030 1157 bp mRNA linear MAM 04-NOV-2015 DEFINITION PREDICTED: Myotis brandtii protein argonaute-2-like (LOC106728082), mRNA. ACCESSION XM_014549030 VERSION XM_014549030.1 DBLINK BioProject: PRJNA218631 KEYWORDS RefSeq; corrected model. SOURCE Myotis brandtii (Brandt's bat) ORGANISM Myotis brandtii Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia; Eutheria; Laurasiatheria; Chiroptera; Yangochiroptera; Vespertilionidae; Myotis. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_005369955.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI Annotation Status :: Full annotation Annotation Version :: Myotis brandtii Annotation Release 101 Annotation Pipeline :: NCBI eukaryotic genome annotation pipeline Annotation Software Version :: 6.4 Annotation Method :: Best-placed RefSeq; Gnomon Features Annotated :: Gene; mRNA; CDS; ncRNA ##Genome-Annotation-Data-END## ##RefSeq-Attributes-START## internal stop codons :: corrected 1 genomic stop codon ##RefSeq-Attributes-END## FEATURES Location/Qualifiers source 1..1157 /organism="Myotis brandtii" /mol_type="mRNA" /db_xref="taxon:109478" /chromosome="Unknown" /sex="male" /geo_loc_name="Russia: Perm poKrai" /lat_lon="58.8348 N 57.6119 E" /collection_date="Dec-2011" /note="collected at hibernation roost" gene 1..1157 /gene="LOC106728082" /note="Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 Protein, and 99% coverage of the annotated genomic feature by RNAseq alignments, including 15 samples with support for all annotated introns" /db_xref="GeneID:106728082" CDS 176..997 /gene="LOC106728082" /note="The sequence of the model RefSeq protein was modified relative to its source genomic sequence to represent the inferred CDS: substituted 1 base at 1 genomic stop codon" /codon_start=1 /transl_except=(pos:743..745,aa:OTHER) /product="LOW QUALITY PROTEIN: protein argonaute-2-like" /protein_id="XP_014404516.1" /db_xref="GeneID:106728082" /translation="
MTCALGPQVELEVTLPGEGKDRIFKVSIKWVSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPVGRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEVLDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASNQTXRLPRPVALPPGRGPVGTVTPGKRIQSVLKLAQGSQTSQWKEPGGSRQPPRCVEQGPLCPELGAEHAGSSGLLSLPQFLGVAPS"
misc_feature <221..361
/gene="LOC106728082"
/note="N-terminal domain of argonaute; Region: ArgoN;
pfam16486"
/db_xref="CDD:465134"
misc_feature 389..541
/gene="LOC106728082"
/note="Argonaute linker 1 domain; Region: ArgoL1;
pfam08699"
/db_xref="CDD:462567"
misc_feature 542..>742
/gene="LOC106728082"
/note="PAZ domain, argonaute_like subfamily. Argonaute is
part of the RNA-induced silencing complex (RISC), and is
an endonuclease that plays a key role in the RNA
interference pathway. The PAZ domain has been named after
the proteins Piwi,Argonaut, and Zwille; Region:
PAZ_argonaute_like; cd02846"
/db_xref="CDD:239212"
ORIGIN
tttctcttcgcgactcgggccctgcagagctcgccgccggttgtttccgtgggggacagaactcccagggcccccgcaggccgccctgcctcttccggggacgcgctcctcagaggagccgacccgaccccgggctacgcgtgaccccctctgacgtggggtgggggccgcgtggatgacctgcgctctgggcccccaggtggagctggaggtcacgctgccgggcgaagggaaggaccgcatcttcaaggtgtccatcaagtgggtgtcctgcgtgagcttgcaggcgttacacgatgcactttcggggcggctgcccagcgtccccttcgagacgatccaggccctcgacgtggtcatgaggcacctgccgtccatgaggtacacgcccgtgggccgctcctttttcaccgcctccgagggctgctccaaccccctgggcggcggccgggaagtgtggttcggcttccatcagtccgtccgcccttctctttggaaaatgatgctaaatattgatgtctcggcaacggcgttctacaaggcacagccagtcatcgagtttgtttgtgaagttttggattttaaaagtattgaagaacaacaaaaacctctgacagattcccaaagggtcaagtttaccaaagaaatcaaaggtctgaaggtggagatcactcactgtgggcagatgaagaggaagtaccgcgtctgcaacgtgacccggcggccggccagcaaccaaacgtaacggctcccccggcccgtggccctcccgccaggcaggggcccagtggggacagtgactccgggaaaaaggatccagtcggttttgaaattagcccagggttcccaaacctcccagtggaaggaacctgggggctcccgccagcccccccgctgtgtagagcaggggcccctctgtcccgagcttggggctgagcatgctgggagcagcgggctgctctccctcccccagttcctgggcgtggccccgtcttagctgtgaggggccctggcttcacttaccagccggatccagggccctgaagtgactgccaggctgcagggtgggcaccgtcctggggagaagcagtaggtgcgcccccctctcctccgcatggtctcctggcccagagggtgtggggcactggtcccgcacc
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]