GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-29 00:40:09, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_002490801             306 bp    mRNA    linear   PLN 17-FEB-2023
DEFINITION  Komagataella phaffii GS115 60S ribosomal protein L36
            (PAS_FragB_0036), partial mRNA.
ACCESSION   XM_002490801
VERSION     XM_002490801.1
DBLINK      BioProject: PRJNA39439
            BioSample: SAMEA2272385
KEYWORDS    RefSeq.
SOURCE      Komagataella phaffii GS115
  ORGANISM  Komagataella phaffii GS115
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Pichiomycetes; Pichiales; Pichiaceae; Komagataella.
REFERENCE   1
  AUTHORS   De Schutter,K., Lin,Y.C., Tiels,P., Van Hecke,A., Glinka,S.,
            Weber-Lehmann,J., Rouze,P., Van de Peer,Y. and Callewaert,N.
  TITLE     Genome sequence of the recombinant protein production host Pichia
            pastoris
  JOURNAL   Nat. Biotechnol. 27 (6), 561-566 (2009)
   PUBMED   19465926
REFERENCE   2  (bases 1 to 306)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (17-FEB-2023) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   3  (bases 1 to 306)
  AUTHORS   Callewaert,N.
  TITLE     Direct Submission
  JOURNAL   Submitted (05-MAY-2009) Callewaert N., Department for Molecular
            Biomedical Research, Flanders Institute for Biotechnology (VIB) /
            Gent University, Technologiepark 927, Ghent, 9052, BELGIUM
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_012963).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..306
                     /organism="Komagataella phaffii GS115"
                     /mol_type="mRNA"
                     /strain="GS115"
                     /db_xref="taxon:644223"
                     /chromosome="1"
     gene            <1..>306
                     /locus_tag="PAS_FragB_0036"
                     /db_xref="GeneID:8197478"
     CDS             1..306
                     /locus_tag="PAS_FragB_0036"
                     /codon_start=1
                     /product="60S ribosomal protein L36"
                     /protein_id="XP_002490846.1"
                     /db_xref="EnsemblGenomes-Gn:PAS_FragB_0036"
                     /db_xref="EnsemblGenomes-Tr:CAY68566"
                     /db_xref="GeneID:8197478"
                     /db_xref="GOA:C4QZ92"
                     /db_xref="InterPro:IPR000509"
                     /db_xref="UniProtKB/TrEMBL:C4QZ92"
                     /translation="
MRNIVLTNSGIAVGANKGHKVTPKAVAPQKRVAISQRTDFVRKLVREVTGLSPYERRIIELIRNSGEKRARKFAKKRLGTHTRAKAKLEEMQNVIQEAKRH"
     misc_feature    25..300
                     /locus_tag="PAS_FragB_0036"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atgagaaatattgtactaacaaattcaggtattgcagtaggtgctaacaagggacacaaggtcaccccaaaggccgttgctccacaaaagagagtcgctatcagccaaagaactgactttgttagaaagttggtccgtgaggtcactggtctgtctccatacgaaagaagaatcattgagttgatcagaaactctggtgagaagagagccagaaagttcgccaagaagagattgggtactcacaccagagctaaggctaagttggaagagatgcaaaacgttatccaggaagcaaagcgtcattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]