GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-17 14:29:10, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_014251223             676 bp    mRNA    linear   VRT 21-SEP-2015
DEFINITION  PREDICTED: Pseudopodoces humilis VCP-interacting membrane
            selenoprotein (VIMP), transcript variant X2, mRNA.
ACCESSION   XM_014251223
VERSION     XM_014251223.1
DBLINK      BioProject: PRJNA217046
KEYWORDS    RefSeq.
SOURCE      Pseudopodoces humilis (Tibetan ground-tit)
  ORGANISM  Pseudopodoces humilis
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Archelosauria; Archosauria; Dinosauria; Saurischia; Theropoda;
            Coelurosauria; Aves; Neognathae; Neoaves; Telluraves; Australaves;
            Passeriformes; Paridae; Pseudopodoces.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_005087564.1) annotated using gene prediction method: Gnomon,
            supported by EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Pseudopodoces humilis Annotation
                                           Release 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 6.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..676
                     /organism="Pseudopodoces humilis"
                     /mol_type="mRNA"
                     /db_xref="taxon:181119"
                     /chromosome="Unknown"
     gene            1..676
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 EST, and 100% coverage of the
                     annotated genomic feature by RNAseq alignments, including
                     2 samples with support for all annotated introns"
                     /db_xref="GeneID:102106040"
     CDS             14..571
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S isoform X2"
                     /protein_id="XP_014106698.1"
                     /db_xref="GeneID:102106040"
                     /translation="
MEPGGDGPAAGPGPALGRGGLEALQHTAGSVLSSYGWYMLLAVVAVYLLVQKVSRSLASRPSGRPGAAEAAEEPDAVVRRQEALAAARLRMQEELNAQAERYKEKQRQLEEERRRQKIAMWESMQEGKSYKGNLKLNQQEVESGASASAVPKSKPNKKPLRGGDYSLQDWNKGLSPWLLGLLENR"
     misc_feature    71..511
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      
tcggcggcgggtgatggagcccgggggtgacggtcccgcggcagggcccgggccggcgctgggccggggcggcctggaggccctgcagcacacggcgggctcggtgctgtccagctatggctggtacatgctcctggccgtcgtcgccgtgtatcttctcgtgcagaaggtgtcccgcagcctggcgtcgcggccgagcggccggcccggagcagctgaggcggccgaggaacctgatgcagtggtgagaaggcaggaagctttggcagcagctcgcctcaggatgcaagaggaattgaatgcacaagcagaaagatacaaggaaaagcaaagacagctggaggaggagaggcgaaggcagaagatcgcgatgtgggagagtatgcaagaaggaaaaagctacaaaggaaacctgaaactgaatcagcaagaagtagaatctggtgcctctgcctcagcagtcccaaaatctaaaccaaacaaaaagcctttgagaggaggtgactactccttgcaggactggaataagggattaagtccctggctgttggggctcttggagaacagataacactctacagagtttactgctataacccactgtctggagaaggaggagggacgtgctcctggagacccggccggcggggcccgtcagcaggtggatgaggctaac
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]