ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-10 12:23:40, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_078012759 496 bp mRNA linear INV 09-DEC-2025 DEFINITION PREDICTED: Saccoglossus kowalevskii protein argonaute-2-like (LOC144359645), partial mRNA. ACCESSION XM_078012759 VERSION XM_078012759.1 DBLINK BioProject: PRJNA42857 KEYWORDS RefSeq. SOURCE Saccoglossus kowalevskii ORGANISM Saccoglossus kowalevskii Eukaryota; Metazoa; Hemichordata; Enteropneusta; Harrimaniidae; Saccoglossus. COMMENT MODEL REFSEQ: This record is predicted by automated computational analysis. This record is derived from a genomic sequence (NW_003141868.1) annotated using gene prediction method: Gnomon. Also see: Documentation of NCBI's Annotation Process ##Genome-Annotation-Data-START## Annotation Provider :: NCBI RefSeq Annotation Status :: Full annotation Annotation Name :: GCF_000003605.3-RS_2025_12 Annotation Pipeline :: NCBI Eukaryotic Genome Annotation Pipeline (EGAP) Annotation Software Version :: 10.5 Annotation Method :: Best-placed RefSeq; Gnomon; cmsearch; tRNAscan-SE Features Annotated :: Gene; mRNA; CDS; ncRNA Annotation Date :: 12/05/2025 ##Genome-Annotation-Data-END## COMPLETENESS: incomplete on the 5' end. FEATURES Location/Qualifiers source 1..496 /organism="Saccoglossus kowalevskii" /mol_type="mRNA" /isolation_source="beach area of Waquoit Pond near Woods Hole, MA" /db_xref="taxon:10224" /chromosome="Unknown" /sex="male" /tissue_type="testes" /geo_loc_name="USA: MA" gene <1..496 /gene="LOC144359645" /note="protein argonaute-2-like; Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 15 long SRA reads, and 88% coverage of the annotated genomic feature by RNAseq alignments, including 7 samples with support for all annotated introns" /db_xref="GeneID:144359645" CDS <1..407 /gene="LOC144359645" /codon_start=3 /product="protein argonaute-2-like" /protein_id="XP_077868885.1" /db_xref="GeneID:144359645" /translation="
SATAFYKSQSVIDFLCEVLDFRDINEQRRPLTDSQRVKFTKEIKGLKVEITHCGTMRRKYRVCNVTRRPAQTQTFPLQLESGQTVECTVAKYFKDRHKLNLQYPYLPCLQVGQEQKHTYLPLEVSIVFYSLVVL"
misc_feature 24..374
/gene="LOC144359645"
/note="PAZ domain, argonaute_like subfamily. Argonaute is
part of the RNA-induced silencing complex (RISC), and is
an endonuclease that plays a key role in the RNA
interference pathway. The PAZ domain has been named after
the proteins Piwi,Argonaut, and Zwille; Region:
PAZ_argonaute_like; cd02846"
/db_xref="CDD:239212"
misc_feature order(180..182,225..227,267..269,279..281,333..335,
354..356,360..362)
/gene="LOC144359645"
/note="nucleic acid-binding interface [nucleotide
binding]; other site"
/db_xref="CDD:239212"
ORIGIN
tgtctgccactgccttttataagtcacagtcagttatagattttctgtgtgaagtcttggatttccgcgatataaatgaacaacgtagacctttaacagactctcaaagggttaaatttactaaagaaattaaaggtttgaaagttgaaatcacccactgtggtactatgcgaagaaaatacagagtgtgcaatgtgacaagacgaccagcacaaactcaaacatttccacttcagttagagtctggtcagactgtagagtgtactgtggctaaatattttaaagatagacataagttaaatttacagtatccttatctaccatgtttacaagttggacaagaacaaaaacatacttacctgccattggaggttagcattgtattctatagtcttgtagtgctctgattcagacagtactgtcatgtagtcttgatgtgtgatttacattgctttatagtttgatagtttgaattctctagtctagtcaacatgtt
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]