ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-10 07:38:08, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_068368358 740 bp mRNA linear INV 16-SEP-2024
DEFINITION PREDICTED: Palaemon carinicauda neurofilament heavy
polypeptide-like (LOC137635915), partial mRNA.
ACCESSION XM_068368358
VERSION XM_068368358.1
DBLINK BioProject: PRJNA1159288
KEYWORDS RefSeq; includes ab initio.
SOURCE Palaemon carinicauda
ORGANISM Palaemon carinicauda
Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Crustacea;
Multicrustacea; Malacostraca; Eumalacostraca; Eucarida; Decapoda;
Pleocyemata; Caridea; Palaemonoidea; Palaemonidae; Palaemon.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NW_027169566) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_036898095.1-RS_2024_09
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.3
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
Annotation Date :: 09/11/2024
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 100% of CDS bases
##RefSeq-Attributes-END##
COMPLETENESS: incomplete on the 5' end.
FEATURES Location/Qualifiers
source 1..740
/organism="Palaemon carinicauda"
/mol_type="mRNA"
/isolate="YSFRI2023"
/isolation_source="Closed colony"
/db_xref="taxon:392227"
/chromosome="Unknown"
/tissue_type="muscle"
/geo_loc_name="China: Rizhao, Shandong"
/collection_date="2020-10"
gene <1..740
/gene="LOC137635915"
/note="neurofilament heavy polypeptide-like; Derived by
automated computational analysis using gene prediction
method: Gnomon. Supporting evidence includes similarity
to: 5 Proteins"
/db_xref="GeneID:137635915"
CDS <1..740
/gene="LOC137635915"
/codon_start=3
/product="neurofilament heavy polypeptide-like"
/protein_id="XP_068224459.1"
/db_xref="GeneID:137635915"
/translation="
EFKSKEEFKSKDEFKSKEEFKSRDEFKSKDELKSKDEFKSKEEFKSRDEFKSKDEFKSKEEFKSKDEFKCKDELKSKDELKSRDEFKSKEEFKSKDEFKCKDELKSKDELKSKDEFKSKEEFKSKDEFKCKDELKSKDELKSKDEFKSKEEFKSKDEFKCKDELKSKDELKSKDEFKSKDEFKSKYEFKSKDEFKSKEEFQSKDVFKFKEEFQSKDELKSKESKSKDEFKSKEEVKSKDELRCLL"
misc_feature <12..>725
/gene="LOC137635915"
/note="cell wall-binding protein EntB; Region:
wall_bind_EntB; NF040676"
/db_xref="CDD:468642"
ORIGIN
atgagttcaaatctaaggaggaattcaaatccaaagatgagttcaaatctaaggaggaattcaaatccagagatgagttcaaatccaaagatgagttaaaatccaaagatgagttcaaatccaaggaggagttcaaatccagagatgagttcaaatccaaagatgagttcaaatccaaggaggagttcaaatccaaggatgagttcaaatgcaaagatgagttaaaatccaaagatgagttaaaatccagagatgagttcaaatccaaggaggagttcaaatccaaggatgagttcaaatgcaaagatgagttaaaatccaaagatgagttaaaatccaaagatgagttcaaatccaaggaggagttcaaatccaaggatgagttcaaatgcaaagatgagttaaaatccaaagatgagttaaaatccaaagatgagttcaaatccaaggaggagttcaaatccaaggatgagttcaaatgcaaagatgagttaaaatccaaagatgagttaaaatccaaagatgagttcaaatccaaggatgagttcaaatccaaatatgagttcaaatccaaagatgagttcaaatccaaggaggagttccaatcaaaagatgtgttcaaattcaaggaggagttccaatccaaagatgagctaaaatccaaggagtcaaaatccaaggatgagttcaaatccaaggaggaggtaaaatccaaggatgagctccggtgcttgctttga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]