ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-10 08:50:58, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_056924418 438 bp mRNA linear PLN 06-JUN-2023
DEFINITION Penicillium angulare uncharacterized protein (N7478_008204),
partial mRNA.
ACCESSION XM_056924418
VERSION XM_056924418.1
DBLINK BioProject: PRJNA973687
BioSample: SAMN30185293
KEYWORDS RefSeq.
SOURCE Penicillium angulare
ORGANISM Penicillium angulare
Eukaryota; Fungi; Dikarya; Ascomycota; Pezizomycotina;
Eurotiomycetes; Eurotiomycetidae; Eurotiales; Aspergillaceae;
Penicillium.
REFERENCE 1 (bases 1 to 438)
AUTHORS Petersen,C., Sorensen,T., Nielsen,M.R., Sondergaard,T.E.,
Sorensen,J.L., Fitzpatrick,D.A., Frisvad,J.C. and Nielsen,K.L.
TITLE Comparative genomic study of the Penicillium genus elucidates a
diverse pangenome and 15 lateral gene transfer events
JOURNAL IMA Fungus 14 (1), 3 (2023)
PUBMED 36726175
REMARK Publication Status: Online-Only
REFERENCE 2 (bases 1 to 438)
CONSRTM NCBI Genome Project
TITLE Direct Submission
JOURNAL Submitted (06-JUN-2023) National Center for Biotechnology
Information, NIH, Bethesda, MD 20894, USA
REFERENCE 3 (bases 1 to 438)
AUTHORS Petersen,C.
TITLE Direct Submission
JOURNAL Submitted (13-DEC-2022) Department of Chemistry and Bioscience,
Aalborg University, Fredrik Bajers Vej 7H, Aalborg, Nordjylland
9220, Denmark
COMMENT PROVISIONAL REFSEQ: This record has not yet been subject to final
NCBI review. This record is derived from an annotated genomic
sequence (NW_026623164).
COMPLETENESS: incomplete on both ends.
FEATURES Location/Qualifiers
source 1..438
/organism="Penicillium angulare"
/mol_type="mRNA"
/strain="IBT 27051"
/culture_collection="IBT:27051"
/type_material="culture from type material of Penicillium
angulare"
/db_xref="taxon:116970"
/chromosome="Unknown"
gene <1..>438
/locus_tag="N7478_008204"
/db_xref="GeneID:81614665"
CDS 1..438
/locus_tag="N7478_008204"
/codon_start=1
/product="uncharacterized protein"
/protein_id="XP_056777144.1"
/db_xref="GeneID:81614665"
/translation="
MRAALTCSCSHGFYMERKIVYSVGLGFMIFSKVSLKKTDRLVLDTEIINLFLINLITTATIEALRDMVDNVLREVVTRRSVILARKIVNVAKNNILVLIINVRFRDPRGLLKNEFWILGDGCLLLLWMGFRLSSSSSSSRRWSRL"
ORIGIN
atgcgcgccgctttgacgtgcagttgttcccatggattctatatggagaggaaaattgtgtacagcgttggtttgggatttatgattttcagcaaagtcagtctcaaaaagactgataggctcgtccttgacacggagattatcaatctcttcttgatcaatctcatcaccactgccaccatcgaagctctcagggatatggtagacaacgtcctcagagaagttgtaactcgcagaagtgtcattctcgcacgcaaaatcgtcaatgttgccaaaaacaacatcctcgttctcataatcaatgtccgattcagagacccccggggcctgctcaagaacgaattctggatcctcggggacggctgccttcttttgctgtggatgggatttcggttgagcagcagcagcagcagcagcagaagatggagcagactgtaa
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]