ver.2
Home
|
Help
|
Advanced search
Previous release (v1)
2026-06-10 11:05:14, GGRNA.v2 : RefSeq release 233 (Jan, 2026)
LOCUS XM_052921962 1386 bp mRNA linear INV 13-JAN-2023
DEFINITION PREDICTED: Mya arenaria melanopsin-like (LOC128215251), mRNA.
ACCESSION XM_052921962
VERSION XM_052921962.1
DBLINK BioProject: PRJNA918361
KEYWORDS RefSeq; includes ab initio.
SOURCE Mya arenaria
ORGANISM Mya arenaria
Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia;
Autobranchia; Heteroconchia; Euheterodonta; Imparidentia;
Neoheterodontei; Myida; Myoidea; Myidae; Mya.
COMMENT MODEL REFSEQ: This record is predicted by automated computational
analysis. This record is derived from a genomic sequence
(NC_069123) annotated using gene prediction method: Gnomon.
Also see:
Documentation of NCBI's Annotation Process
##Genome-Annotation-Data-START##
Annotation Provider :: NCBI RefSeq
Annotation Status :: Full annotation
Annotation Name :: GCF_026914265.1-RS_2023_01
Annotation Pipeline :: NCBI eukaryotic genome annotation
pipeline
Annotation Software Version :: 10.1
Annotation Method :: Gnomon; cmsearch; tRNAscan-SE
Features Annotated :: Gene; mRNA; CDS; ncRNA
##Genome-Annotation-Data-END##
##RefSeq-Attributes-START##
ab initio :: 34% of CDS bases
##RefSeq-Attributes-END##
FEATURES Location/Qualifiers
source 1..1386
/organism="Mya arenaria"
/mol_type="mRNA"
/isolate="MELC-2E11"
/db_xref="taxon:6604"
/chromosome="2"
/sex="female"
/tissue_type="Siphon/mantle"
/geo_loc_name="USA: Larrabe Cove, Machiasport, ME"
/collection_date="2018-06-01"
gene 1..1386
/gene="LOC128215251"
/note="melanopsin-like; Derived by automated computational
analysis using gene prediction method: Gnomon. Supporting
evidence includes similarity to: 6 Proteins"
/db_xref="GeneID:128215251"
CDS 1..1386
/gene="LOC128215251"
/codon_start=1
/product="melanopsin-like"
/protein_id="XP_052777922.1"
/db_xref="GeneID:128215251"
/translation="
MNLNNKPDPSTVLQMVYLHCCAMNKDELEQQATPSTVLQMVYLHCCAMNKDELEQQATPSTVLQMVYLHCCAMNKDELEQQATPSTVLQMVYIHCCAMNKDELEQQATPSTVLQMVYLHCCAMNKDELEQQATTSTVLQMVYLHCCVMHKDELEQQARPQFRSLRTYSNMFVLNLTVADFLLAVGNMPMFTASSFWGYWVFGSSGCIAYAFAGSVASFVSINTLAAIAIDRCFVIIRTLPLQNRMSRKTFCSIIGSVWIYSILWASGPFVGFGHYILEGTNTSCTFDFLTRDLSSRLYVICIFTAHFIIPVLVIAGSYTMIFRTIKIYKHEFNEATKVHGEEELPMPMRKCNTRFSHEAKTARVSIIVISVFCISWTPYATVALIGEFGHSAIITRLGSGIPCLLAKCSTIINPLIYALLHPKFRTKLLGVIACFKHEEERREEEYRRGIIHFRSRKQCSL"
misc_feature 481..1284
/gene="LOC128215251"
/note="seven-transmembrane G protein-coupled receptor
superfamily; Region: 7tm_GPCRs; cl28897"
/db_xref="CDD:475119"
misc_feature 505..573
/gene="LOC128215251"
/note="TM helix 2 [structural motif]; Region: TM helix 2"
/db_xref="CDD:320211"
misc_feature 619..687
/gene="LOC128215251"
/note="TM helix 3 [structural motif]; Region: TM helix 3"
/db_xref="CDD:320211"
misc_feature 754..804
/gene="LOC128215251"
/note="TM helix 4 [structural motif]; Region: TM helix 4"
/db_xref="CDD:320211"
misc_feature 886..957
/gene="LOC128215251"
/note="TM helix 5 [structural motif]; Region: TM helix 5"
/db_xref="CDD:320211"
misc_feature 1084..1152
/gene="LOC128215251"
/note="TM helix 6 [structural motif]; Region: TM helix 6"
/db_xref="CDD:320211"
misc_feature 1186..1263
/gene="LOC128215251"
/note="TM helix 7 [structural motif]; Region: TM helix 7"
/db_xref="CDD:320211"
ORIGIN
atgaacttgaacaacaagccagaccccagtactgtgttacaaatggtatatcttcactgctgtgccatgaacaaggatgaactcgaacaacaagccacccccagtactgtgttacaaatggtatatcttcactgctgtgccatgaacaaggatgaactcgaacaacaagccacccccagtactgtgttacaaatggtatatcttcactgctgtgccatgaacaaggatgaactcgaacaacaagccacccccagtactgtgttacaaatggtatatattcactgctgtgccatgaacaaggatgaactcgaacaacaagccacccccagtactgtgttacaaatggtatatcttcactgctgtgccatgaacaaggatgaacttgaacaacaagccaccaccagtactgtgttacaaatggtatatcttcactgctgtgtcatgcacaaggatgaactcgaacaacaagccagacctcagtttcgcagcctcaggacgtattcgaacatgtttgtattgaacctgacggtggcggacttcctgctggcggtcggcaacatgcccatgttcaccgcctccagcttctggggctactgggtgtttggatcttcaggctgtatagcgtacgccttcgccggttccgttgcaagtttcgtgtccataaatacgttggcagcgatcgctattgacagatgctttgtcattattcggacgttaccgctacaaaaccgaatgtccagaaaaacattttgctcaataattggatctgtatggatttattcaattttgtgggcaagcggtccatttgttggcttcggccattatatattagaaggaaccaatacatcatgtacatttgatttccttactagagatttgagttcaaggttatatgttatttgcatcttcaccgcccatttcattattccagtattagtgatagcaggttcgtatacaatgatatttcggacaatcaaaatatataaacacgaattcaacgaagcaaccaaagtccacggcgaggaggagttaccaatgcccatgcgtaaatgtaatactaggttttcacacgaagctaaaactgctcgtgtttctatcattgtcatttccgtgttttgtatctcatggactccttacgctacagttgccttaatcggggaatttggacattcggcaatcattacacgactaggctcgggtataccgtgccttttagcaaaatgctcaactataatcaacccccttatttacgctttgttgcaccctaaattcagaacaaagctgcttggtgtcattgcgtgttttaaacatgaagaggagagacgagaggaagaataccgtcgtggcatcatccacttccggtcccgaaaacagtgctccttgtga
//
by
@meso_cacase at
DBCLS
This page is licensed under a
Creative Commons Attribution 4.0 International License (CC BY 4.0).
If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596.
[Full Text]