GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-10 11:05:14, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_052921962            1386 bp    mRNA    linear   INV 13-JAN-2023
DEFINITION  PREDICTED: Mya arenaria melanopsin-like (LOC128215251), mRNA.
ACCESSION   XM_052921962
VERSION     XM_052921962.1
DBLINK      BioProject: PRJNA918361
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Mya arenaria
  ORGANISM  Mya arenaria
            Eukaryota; Metazoa; Spiralia; Lophotrochozoa; Mollusca; Bivalvia;
            Autobranchia; Heteroconchia; Euheterodonta; Imparidentia;
            Neoheterodontei; Myida; Myoidea; Myidae; Mya.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_069123) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Full annotation
            Annotation Name             :: GCF_026914265.1-RS_2023_01
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.1
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 34% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..1386
                     /organism="Mya arenaria"
                     /mol_type="mRNA"
                     /isolate="MELC-2E11"
                     /db_xref="taxon:6604"
                     /chromosome="2"
                     /sex="female"
                     /tissue_type="Siphon/mantle"
                     /geo_loc_name="USA: Larrabe Cove, Machiasport, ME"
                     /collection_date="2018-06-01"
     gene            1..1386
                     /gene="LOC128215251"
                     /note="melanopsin-like; Derived by automated computational
                     analysis using gene prediction method: Gnomon. Supporting
                     evidence includes similarity to: 6 Proteins"
                     /db_xref="GeneID:128215251"
     CDS             1..1386
                     /gene="LOC128215251"
                     /codon_start=1
                     /product="melanopsin-like"
                     /protein_id="XP_052777922.1"
                     /db_xref="GeneID:128215251"
                     /translation="
MNLNNKPDPSTVLQMVYLHCCAMNKDELEQQATPSTVLQMVYLHCCAMNKDELEQQATPSTVLQMVYLHCCAMNKDELEQQATPSTVLQMVYIHCCAMNKDELEQQATPSTVLQMVYLHCCAMNKDELEQQATTSTVLQMVYLHCCVMHKDELEQQARPQFRSLRTYSNMFVLNLTVADFLLAVGNMPMFTASSFWGYWVFGSSGCIAYAFAGSVASFVSINTLAAIAIDRCFVIIRTLPLQNRMSRKTFCSIIGSVWIYSILWASGPFVGFGHYILEGTNTSCTFDFLTRDLSSRLYVICIFTAHFIIPVLVIAGSYTMIFRTIKIYKHEFNEATKVHGEEELPMPMRKCNTRFSHEAKTARVSIIVISVFCISWTPYATVALIGEFGHSAIITRLGSGIPCLLAKCSTIINPLIYALLHPKFRTKLLGVIACFKHEEERREEEYRRGIIHFRSRKQCSL"
     misc_feature    481..1284
                     /gene="LOC128215251"
                     /note="seven-transmembrane G protein-coupled receptor
                     superfamily; Region: 7tm_GPCRs; cl28897"
                     /db_xref="CDD:475119"
     misc_feature    505..573
                     /gene="LOC128215251"
                     /note="TM helix 2 [structural motif]; Region: TM helix 2"
                     /db_xref="CDD:320211"
     misc_feature    619..687
                     /gene="LOC128215251"
                     /note="TM helix 3 [structural motif]; Region: TM helix 3"
                     /db_xref="CDD:320211"
     misc_feature    754..804
                     /gene="LOC128215251"
                     /note="TM helix 4 [structural motif]; Region: TM helix 4"
                     /db_xref="CDD:320211"
     misc_feature    886..957
                     /gene="LOC128215251"
                     /note="TM helix 5 [structural motif]; Region: TM helix 5"
                     /db_xref="CDD:320211"
     misc_feature    1084..1152
                     /gene="LOC128215251"
                     /note="TM helix 6 [structural motif]; Region: TM helix 6"
                     /db_xref="CDD:320211"
     misc_feature    1186..1263
                     /gene="LOC128215251"
                     /note="TM helix 7 [structural motif]; Region: TM helix 7"
                     /db_xref="CDD:320211"
ORIGIN      
atgaacttgaacaacaagccagaccccagtactgtgttacaaatggtatatcttcactgctgtgccatgaacaaggatgaactcgaacaacaagccacccccagtactgtgttacaaatggtatatcttcactgctgtgccatgaacaaggatgaactcgaacaacaagccacccccagtactgtgttacaaatggtatatcttcactgctgtgccatgaacaaggatgaactcgaacaacaagccacccccagtactgtgttacaaatggtatatattcactgctgtgccatgaacaaggatgaactcgaacaacaagccacccccagtactgtgttacaaatggtatatcttcactgctgtgccatgaacaaggatgaacttgaacaacaagccaccaccagtactgtgttacaaatggtatatcttcactgctgtgtcatgcacaaggatgaactcgaacaacaagccagacctcagtttcgcagcctcaggacgtattcgaacatgtttgtattgaacctgacggtggcggacttcctgctggcggtcggcaacatgcccatgttcaccgcctccagcttctggggctactgggtgtttggatcttcaggctgtatagcgtacgccttcgccggttccgttgcaagtttcgtgtccataaatacgttggcagcgatcgctattgacagatgctttgtcattattcggacgttaccgctacaaaaccgaatgtccagaaaaacattttgctcaataattggatctgtatggatttattcaattttgtgggcaagcggtccatttgttggcttcggccattatatattagaaggaaccaatacatcatgtacatttgatttccttactagagatttgagttcaaggttatatgttatttgcatcttcaccgcccatttcattattccagtattagtgatagcaggttcgtatacaatgatatttcggacaatcaaaatatataaacacgaattcaacgaagcaaccaaagtccacggcgaggaggagttaccaatgcccatgcgtaaatgtaatactaggttttcacacgaagctaaaactgctcgtgtttctatcattgtcatttccgtgttttgtatctcatggactccttacgctacagttgccttaatcggggaatttggacattcggcaatcattacacgactaggctcgggtataccgtgccttttagcaaaatgctcaactataatcaacccccttatttacgctttgttgcaccctaaattcagaacaaagctgcttggtgtcattgcgtgttttaaacatgaagaggagagacgagaggaagaataccgtcgtggcatcatccacttccggtcccgaaaacagtgctccttgtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]