LOCUS       XM_041595530             740 bp    mRNA    linear   INV 14-MAY-2021
DEFINITION  PREDICTED: Drosophila obscura protein argonaute-2-like
            (LOC111068737), mRNA.
ACCESSION   XM_041595530
VERSION     XM_041595530.1
DBLINK      BioProject: PRJNA728747
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Drosophila obscura
  ORGANISM  Drosophila obscura
            Eukaryota; Metazoa; Ecdysozoa; Arthropoda; Hexapoda; Insecta;
            Pterygota; Neoptera; Endopterygota; Diptera; Brachycera;
            Muscomorpha; Ephydroidea; Drosophilidae; Drosophila; Sophophora.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_024542865.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Drosophila obscura Annotation
                                           Release 101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.6
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 11% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..740
                     /organism="Drosophila obscura"
                     /mol_type="mRNA"
                     /isolate="BZ-5 IFL"
                     /db_xref="taxon:7282"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="whole fly"
                     /dev_stage="Adult fly"
                     /geo_loc_name="Serbia: Babin Zub"
                     /collection_date="2017"
     gene            1..740
                     /gene="LOC111068737"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein, and 94% coverage of the
                     annotated genomic feature by RNAseq alignments"
                     /db_xref="GeneID:111068737"
     CDS             342..740
                     /gene="LOC111068737"
                     /codon_start=1
                     /product="protein argonaute-2-like"
                     /protein_id="XP_041451464.1"
                     /db_xref="GeneID:111068737"
                     /translation="

MCRQYHLKVSRGYTKSMRYKLPASKQTFVADKGRMTVAEYSKSRGRILKYPKLHCLHVGPPQKTIYLPIGMCAAEGKQSVNRNDATLQSAAMDKIAATSSSTSTNARKSKIMELLHCFIASTTTLIRPDLPQ"

     misc_feature    <363..548
                     /gene="LOC111068737"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(396..398,423..425,450..452,462..464,513..515,
                     534..536,540..542)
                     /gene="LOC111068737"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      

ggatctacgagaagcccatgcgagtgctgcagtgtctggagtttgggctagtcgcaccatgccacaaggcaatacggtcgggtcgccgtttctttcagaaatccgagccgggccagtctcatggtctgggcaatggcgaggagattttgttgggtctgttttgaggcgtttgtgctgggcgatcgaccatttgtaaatgtggacatcacccacaagtgcttccaactctcgatgcccataatcgagtacttggagcgctatcagatgggccagcacccaaacaaatatcgagagcaggcgatccgagatagatgcacacattaaaggcatttccatagcctatgtgccgccagtatcacttgaaagtttcacgagggtatacgaagtcaatgcgctacaagctgccggccagcaaacaaacattcgtggcggataaagggaggatgaccgttgcagagtattccaagtcgcgtggccgtattttaaagtatccgaagctgcattgcttgcacgttgggccgccacagaaaaccatttatctgcccattggaatgtgtgccgctgagggaaagcagtcggtgaatcgcaacgacgccacgctgcagtcagcggcgatggataagattgctgccacatcctcatccacatccacaaacgcacgcaagtccaagatcatggagttgcttcattgcttcattgcttcaaccacaactctgatccgacccgacctgccccaatga

//