LOCUS       XM_035982509             652 bp    mRNA    linear   PLN 01-SEP-2020
DEFINITION  PREDICTED: Helianthus annuus protein argonaute 1A (LOC110901336),
            transcript variant X5, mRNA.
ACCESSION   XM_035982509
VERSION     XM_035982509.1
DBLINK      BioProject: PRJNA396063
KEYWORDS    RefSeq.
SOURCE      Helianthus annuus (common sunflower)
  ORGANISM  Helianthus annuus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Asterales; Asteraceae;
            Asteroideae; Heliantheae alliance; Heliantheae; Helianthus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_035445.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Helianthus annuus Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..652
                     /organism="Helianthus annuus"
                     /mol_type="mRNA"
                     /cultivar="XRQ/B"
                     /specimen_voucher="SF193"
                     /db_xref="taxon:4232"
                     /chromosome="13"
                     /tissue_type="leaves"
                     /dev_stage="4 leaves"
                     /geo_loc_name="France"
                     /collected_by="INRA, LIPM"
     gene            1..652
                     /gene="LOC110901336"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 4 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:110901336"
     CDS             92..637
                     /gene="LOC110901336"
                     /codon_start=1
                     /product="protein argonaute 1A isoform X3"
                     /protein_id="XP_035838402.1"
                     /db_xref="GeneID:110901336"
                     /translation="

MGLSLNIDMAATAFVEAVHVIDFVKQLLNRNDTTRPLSDADRIKKALKGVKVEITHRGTMRRRFNISGLTSQATRELQFTVGGDGDTVTKYVVDYFKDAYGFSIQHVHWPCLQLGGTHRKNYMPMEVCKIVAGQRYSRKLNERQVTALLKVTCQRPQDREHGILKVMLSNLPMNHHVMCKS"

     misc_feature    149..484
                     /gene="LOC110901336"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(281..283,326..328,365..367,377..379,431..433,
                     452..454,458..460)
                     /gene="LOC110901336"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      

aaccactgttgagttacaatagtggttgaaactactgggtgacgggttggagagttggcgtgagttctatcagagcatgcggcgtacatagatgggactgtctttaaatatcgatatggctgcaactgcattcgttgaggcagtgcatgtgatagactttgtcaaacaacttctgaataggaatgacacaacaagacctttatctgatgctgaccggataaaaaaagcacttaaaggagtgaaggttgaaataactcaccgtggaactatgcgccggaggtttaacatatccggtttaacatctcaagcaacacgcgagctacagttcacggttggtggtgacggagatacggtgacgaaatatgtggttgattacttcaaggatgcttacgggttttccatccagcatgtacattggccgtgcttgcaacttggcgggacccataggaaaaattatatgcctatggaggtctgcaagattgtagcgggccagaggtattcaaggaagctaaatgagcgacaagttaccgcccttcttaaggtcacgtgtcaacgccctcaggatcgagagcacggtattctcaaggtaatgttatctaatttaccgatgaaccatcatgtcatgtgtaaaagttaacatatgtcttgtatc

//