GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-09-27 22:32:32, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_035982507            1285 bp    mRNA    linear   PLN 01-SEP-2020
DEFINITION  PREDICTED: Helianthus annuus protein argonaute 1A (LOC110901336),
            transcript variant X3, mRNA.
ACCESSION   XM_035982507
VERSION     XM_035982507.1
DBLINK      BioProject: PRJNA396063
KEYWORDS    RefSeq.
SOURCE      Helianthus annuus (common sunflower)
  ORGANISM  Helianthus annuus
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; asterids; campanulids; Asterales; Asteraceae;
            Asteroideae; Heliantheae alliance; Heliantheae; Helianthus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_035445.2) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Name             :: Helianthus annuus Annotation Release
                                           101
            Annotation Version          :: 101
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 8.5
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1285
                     /organism="Helianthus annuus"
                     /mol_type="mRNA"
                     /cultivar="XRQ/B"
                     /specimen_voucher="SF193"
                     /db_xref="taxon:4232"
                     /chromosome="13"
                     /tissue_type="leaves"
                     /dev_stage="4 leaves"
                     /geo_loc_name="France"
                     /collected_by="INRA, LIPM"
     gene            1..1285
                     /gene="LOC110901336"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 100% coverage of the annotated
                     genomic feature by RNAseq alignments, including 44 samples
                     with support for all annotated introns"
                     /db_xref="GeneID:110901336"
     CDS             608..1270
                     /gene="LOC110901336"
                     /codon_start=1
                     /product="protein argonaute 1A isoform X1"
                     /protein_id="XP_035838400.1"
                     /db_xref="GeneID:110901336"
                     /translation="
MVVCIVKHDMEIIHLFTDASSSTIWRSSTFSPMLIPSKSFLTLSLTDMAATAFVEAVHVIDFVKQLLNRNDTTRPLSDADRIKKALKGVKVEITHRGTMRRRFNISGLTSQATRELQFTVGGDGDTVTKYVVDYFKDAYGFSIQHVHWPCLQLGGTHRKNYMPMEVCKIVAGQRYSRKLNERQVTALLKVTCQRPQDREHGILKVMLSNLPMNHHVMCKS"
     misc_feature    782..1117
                     /gene="LOC110901336"
                     /note="PAZ domain, argonaute_like subfamily. Argonaute is
                     part of the RNA-induced silencing complex (RISC), and is
                     an endonuclease that plays a key role in the RNA
                     interference pathway. The PAZ domain has been named after
                     the proteins Piwi,Argonaut, and Zwille; Region:
                     PAZ_argonaute_like; cd02846"
                     /db_xref="CDD:239212"
     misc_feature    order(914..916,959..961,998..1000,1010..1012,1064..1066,
                     1085..1087,1091..1093)
                     /gene="LOC110901336"
                     /note="nucleic acid-binding interface [nucleotide
                     binding]; other site"
                     /db_xref="CDD:239212"
ORIGIN      
attatttattattttatattttattggtggttttgtggcatccgggactgatctagcaaaggtgccctgatctagcaaagccggatttgtatttttagaattttaaggtgcctggcttaggtgattccagttgatggtagcgattgttggtgacggagatgaacttcggctgccagaccacaaccacatgggtttctgatggtgttcgatttcatcaaagtttatgtgataaaaaatgagtatgtgctacgttgacctgctcaagaagaatgaagattgctttgggcacgattcagatgtgtatgcatctccgctatatgcatggtggcgctaccaagtcctttggaaatccacatcgctgcaagttcactggataatccaccatcggacctgtatcttgggtcttttcatgctggtgacgatgttggctccccaaaggggtacctcggatcagctgctctttagaagactacagaagctgatgttgctgggtctctgttctgtccattctgcttctagggggtactcatgagaactggatgcatcagtactggatggttgttcgcatcgtcaagcatgctatggagaaacaaccgtaaaaaggttgatggttgtttgcatcgtcaagcacgatatggagatcatccaccttttcaccgatgcatcgtcaagcacgatatggagatcatccaccttttcaccgatgctaatcccatccaaatcattcttgacgctgtcattaacagatatggctgcaactgcattcgttgaggcagtgcatgtgatagactttgtcaaacaacttctgaataggaatgacacaacaagacctttatctgatgctgaccggataaaaaaagcacttaaaggagtgaaggttgaaataactcaccgtggaactatgcgccggaggtttaacatatccggtttaacatctcaagcaacacgcgagctacagttcacggttggtggtgacggagatacggtgacgaaatatgtggttgattacttcaaggatgcttacgggttttccatccagcatgtacattggccgtgcttgcaacttggcgggacccataggaaaaattatatgcctatggaggtctgcaagattgtagcgggccagaggtattcaaggaagctaaatgagcgacaagttaccgcccttcttaaggtcacgtgtcaacgccctcaggatcgagagcacggtattctcaaggtaatgttatctaatttaccgatgaaccatcatgtcatgtgtaaaagttaacatatgtcttgtatc
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]