GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-10 07:38:07, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_033913633             303 bp    mRNA    linear   PLN 15-JUL-2025
DEFINITION  Saccharomyces paradoxus 60S ribosomal protein eL36 (RPL36B),
            partial mRNA.
ACCESSION   XM_033913633
VERSION     XM_033913633.1
DBLINK      BioProject: PRJNA625777
            BioSample: SAMEA2757769
KEYWORDS    RefSeq.
SOURCE      Saccharomyces paradoxus
  ORGANISM  Saccharomyces paradoxus
            Eukaryota; Fungi; Dikarya; Ascomycota; Saccharomycotina;
            Saccharomycetes; Saccharomycetales; Saccharomycetaceae;
            Saccharomyces.
REFERENCE   1  (bases 1 to 303)
  AUTHORS   Yue,J.X., Li,J., Aigrain,L., Hallin,J., Persson,K., Oliver,K.,
            Bergstrom,A., Coupland,P., Warringer,J., Lagomarsino,M.C.,
            Fischer,G., Durbin,R. and Liti,G.
  TITLE     Contrasting evolutionary genome dynamics between domesticated and
            wild yeasts
  JOURNAL   Nat. Genet. 49 (6), 913-924 (2017)
   PUBMED   28416820
REFERENCE   2  (bases 1 to 303)
  AUTHORS   Yue,J.-X.
  TITLE     Population-level Yeast Reference Genomes
  JOURNAL   Unpublished
REFERENCE   3  (bases 1 to 303)
  CONSRTM   NCBI Genome Project
  TITLE     Direct Submission
  JOURNAL   Submitted (15-JUL-2025) National Center for Biotechnology
            Information, NIH, Bethesda, MD 20894, USA
REFERENCE   4  (bases 1 to 303)
  AUTHORS   Yue,J.-X. and Liti,G.
  TITLE     Direct Submission
  JOURNAL   Submitted (20-JAN-2020) Biotechnology, Delft University of
            Technology, van der Maasweg 9, Delft, Netherlands 2629 HZ,
            Netherlands
  REMARK    Annotation added by submitter
REFERENCE   5  (bases 1 to 303)
  AUTHORS   Yue,J.-X.
  TITLE     Direct Submission
  JOURNAL   Submitted (04-FEB-2017) Institute for Research on Cancer and Aging,
            Nice (IRCAN), Institute for Research on Cancer and Aging, Nice
            (IRCAN), 28 Avenue de Valombrose, Nice, PACA 06107, France
COMMENT     PROVISIONAL REFSEQ: This record has not yet been subject to final
            NCBI review. This record is derived from an annotated genomic
            sequence (NC_047502).
            COMPLETENESS: incomplete on both ends.
FEATURES             Location/Qualifiers
     source          1..303
                     /organism="Saccharomyces paradoxus"
                     /mol_type="mRNA"
                     /strain="CBS432"
                     /type_material="culture from neotype of Saccharomyces
                     paradoxus"
                     /db_xref="taxon:27291"
                     /chromosome="XVI"
     gene            <1..>303
                     /gene="RPL36B"
                     /locus_tag="SPAR_P00270"
                     /db_xref="GeneID:54633969"
     CDS             1..303
                     /gene="RPL36B"
                     /locus_tag="SPAR_P00270"
                     /note="GTPase-activating protein (GAP) for Rab family
                     members;
                     similar to YPL249C"
                     /codon_start=1
                     /product="60S ribosomal protein eL36"
                     /protein_id="XP_033769524.1"
                     /db_xref="GeneID:54633969"
                     /translation="
MAVKTGIAIGLNKGKKVTQMTPAPKISYKKGAASNRTKFVRSLVREIAGLSPYERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH"
     misc_feature    10..297
                     /gene="RPL36B"
                     /locus_tag="SPAR_P00270"
                     /note="Ribosomal protein L36e; Region: Ribosomal_L36e;
                     pfam01158"
                     /db_xref="CDD:460088"
ORIGIN      
atggctgtcaagactggtatcgctattggtttgaacaagggtaagaaagtcacccaaatgactccagctccaaagatctcctacaagaagggtgctgcctctaacagaaccaagttcgtcagatctttggttagagaaatcgccggtttgtccccatacgaaagaagattgatcgatttgatcagaaactccggtgaaaagagagccagaaaggtcgccaagaagagattgggttctttcaccagagccaaggctaaggtcgaagaaatgaacaacatcattgctgcctctcgtcgtcattaa
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]