GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-10 12:23:15, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_029729867            1578 bp    mRNA    linear   VRT 10-JUL-2025
DEFINITION  PREDICTED: Salmo trutta homeobox protein Meis2 (LOC115172431),
            transcript variant X3, mRNA.
ACCESSION   XM_029729867
VERSION     XM_029729867.1
DBLINK      BioProject: PRJNA550988
KEYWORDS    RefSeq.
SOURCE      Salmo trutta (river trout)
  ORGANISM  Salmo trutta
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Actinopterygii; Neopterygii; Teleostei; Protacanthopterygii;
            Salmoniformes; Salmonidae; Salmoninae; Salmo.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NC_042989.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI RefSeq
            Annotation Status           :: Updated annotation
            Annotation Name             :: GCF_901001165.1-RS_2025_07
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 10.4
            Annotation Method           :: Gnomon; cmsearch; tRNAscan-SE
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            Annotation Date             :: 07/09/2025
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1578
                     /organism="Salmo trutta"
                     /mol_type="mRNA"
                     /db_xref="taxon:8032"
                     /chromosome="33"
     gene            1..1578
                     /gene="LOC115172431"
                     /note="homeobox protein Meis2; Derived by automated
                     computational analysis using gene prediction method:
                     Gnomon. Supporting evidence includes similarity to: 33
                     Proteins, and 99% coverage of the annotated genomic
                     feature by RNAseq alignments, including 4 samples with
                     support for all annotated introns"
                     /db_xref="GeneID:115172431"
     CDS             601..1578
                     /gene="LOC115172431"
                     /codon_start=1
                     /product="homeobox protein Meis2 isoform X1"
                     /protein_id="XP_029585727.1"
                     /db_xref="GeneID:115172431"
                     /translation="
MAQRYDELAHYGGMDGVGVPASMYGDPHAPRPLPQVHHLNHGPPLHGQHYGAHAPHPSVMPNSMGSAVNDVLKRDKDQIYGHPLFPLLALVFEKCELATCTPREPGVAGGDVCSSDSFNEDIAVFAKQVRAEKPLFSSNPELDNLMIQAIQVLRFHLLELEKVHELCDNFCHRYISCLKGKMPIDLVIDERDGSSKSDHEELSGSSTNLADHNPASWRDHDDATSTHSAGTPGPSSGGHASQSGDNSSELGDGLENSVASPGTGDDDDPDKEKKRQKKRGIFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNW"
     misc_feature    925..1179
                     /gene="LOC115172431"
                     /note="N-terminal of Homeobox Meis and PKNOX1; Region:
                     Meis_PKNOX_N; pfam16493"
                     /db_xref="CDD:465140"
     misc_feature    1480..>1575
                     /gene="LOC115172431"
                     /note="Homeobox KN domain; Region: Homeobox_KN; pfam05920"
                     /db_xref="CDD:428673"
ORIGIN      
ctatctagagaggggattggacgagagaaacatacaaaattactttctctacaaaagctttttctttttggaaaagttcattctggactgagaaggggtgcgccatatcgtttaatttgctaaacagccccgttcataattagcagtacgattaaaagtaataataaaacaagatagcaatccggaggcataaagaggacgcggacttgctggatgaaaacgggctgaaaagattcatcctctcttgaacatcatcaccaaccatcattcattcattaccttgacaacccctggctttgattgacagctggagtggcaaaaagccacgagacacgacagtttagttacatgcaggttgttgatgggccgattgtaaccttcagtttggtgcttgacatttttttttattttttggggaaagaggaaaacaagaaaaattgcaaaactcctcctgatgcttctgcttgcactctaccacattggagaataggagaattcgcaaagttggttgaaaaaggaatcttaccactaaatcactttctaacctgactgggatattaaatatacgacacatccaggagtttattggagcgcagcctgatggcgcaaaggtacgatgagctggcccattatggtgggatggacggagtcggggtcccggcgtctatgtacggagacccgcatgctccacggccgctaccccaagtccatcacttgaaccatggaccaccgctccatggccagcactacggtgctcatgcaccccatcccagcgttatgcccaacagcatgggctccgctgtcaacgatgttttaaagagggataaagatcaaatctatggtcacccattattcccgctgctcgcgttggtttttgagaagtgcgagctggcgacgtgcactccgagggagcctggggtagcaggcggcgatgtctgctcctccgactccttcaatgaggacatcgcagtctttgccaaacaggtccgagcagaaaaacctttattttcatcaaatccagagttggacaatttgatgatacaagccatacaagtattacgatttcaccttttggaattagaaaaggtgcacgagctctgcgacaatttttgccaccggtacatcagttgtttgaaaggaaaaatgccaatagatctagttattgacgagcgggatggcagctcgaagtcagaccacgaagagctctcaggatcttcgaccaacctagccgatcacaacccagcttcctggagagaccacgatgacgccacctccacacactcggccggcacgccagggccctccagcgggggccacgcttcacagagcggcgacaacagcagcgaactaggagatggtttagagaacagcgtggcgtctcctggcacaggggatgatgatgatccggacaaggagaagaagaggcagaagaagcgcggcatcttccccaaggtggccaccaacatcatgagggcgtggctgttccagcatctcacgcacccgtacccttctgaagaacagaaaaagcagctagcccaagacacaggcctgaccatcttacaagtaaacaactggtga
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]