LOCUS       XM_021443097             417 bp    mRNA    linear   PLN 09-JUN-2017
DEFINITION  PREDICTED: Herrania umbratica uncharacterized LOC110427542
            (LOC110427542), mRNA.
ACCESSION   XM_021443097
VERSION     XM_021443097.1
DBLINK      BioProject: PRJNA389730
KEYWORDS    RefSeq; includes ab initio.
SOURCE      Herrania umbratica
  ORGANISM  Herrania umbratica
            Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
            Spermatophyta; Magnoliopsida; eudicotyledons; Gunneridae;
            Pentapetalae; rosids; malvids; Malvales; Malvaceae; Byttnerioideae;
            Herrania.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_018397275.1) annotated using gene prediction method: Gnomon.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Herrania umbratica Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.4
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
            
            ##RefSeq-Attributes-START##
            ab initio :: 100% of CDS bases
            ##RefSeq-Attributes-END##
FEATURES             Location/Qualifiers
     source          1..417
                     /organism="Herrania umbratica"
                     /mol_type="mRNA"
                     /cultivar="Fairchild"
                     /db_xref="taxon:108875"
                     /chromosome="Unknown"
                     /tissue_type="leaf"
                     /dev_stage="mature"
                     /geo_loc_name="USA: Fairchild Tropical Gardens, Miami, FL"
                     /collection_date="2016-10"
                     /collected_by="Dayana Rodezno"
     gene            1..417
                     /gene="LOC110427542"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 1 Protein"
                     /db_xref="GeneID:110427542"
     CDS             1..417
                     /gene="LOC110427542"
                     /codon_start=1
                     /product="uncharacterized protein LOC110427542"
                     /protein_id="XP_021298772.1"
                     /db_xref="GeneID:110427542"
                     /translation="

MAECSSIRPHVLKMIELIERLGQLGLAMDHELSIDLVLQSLLDSFSQFMLNFHMNRLEATFLELLNMLNMVEWSIRKDKGSLLLVSSFEAHTKQQKKKAQKGKKVKSQNEKVLKPKRGVKKDKEKDILPSLWQTWALE"

     misc_feature    <1..>144
                     /gene="LOC110427542"
                     /note="gag-polypeptide of LTR copia-type; Region:
                     Retrotran_gag_2; pfam14223"
                     /db_xref="CDD:464108"
ORIGIN      

atggcagaatgcagttctattagaccccatgtgctgaagatgattgaactcatcgagagacttggacaattgggattagcaatggatcatgagcttagtatagacttagttctacaatctcttcttgacagctttagtcagttcatgttgaacttccatatgaatcgattggaagccacttttcttgaacttttgaatatgctaaacatggtagagtggtccatcaggaaagataaaggatcattgcttcttgtttcttcttttgaggctcatacgaaacaacagaagaagaaagcccaaaaagggaagaaggtaaaatctcaaaatgagaaggtgctgaagcctaagagaggtgtcaaaaaggacaaagagaaagatattttgccatcattgtggcaaacttgggcattggaatag

//