GGRNA ver.2 Home | Help | Advanced search    Previous release (v1)

2026-06-10 14:24:45, GGRNA.v2 : RefSeq release 233 (Jan, 2026)

LOCUS       XM_017863385            1253 bp    mRNA    linear   PRI 24-AUG-2016
DEFINITION  PREDICTED: Rhinopithecus bieti VCP interacting membrane
            selenoprotein (VIMP), transcript variant X2, mRNA.
ACCESSION   XM_017863385
VERSION     XM_017863385.1
DBLINK      BioProject: PRJNA339282
KEYWORDS    RefSeq.
SOURCE      Rhinopithecus bieti (black snub-nosed monkey)
  ORGANISM  Rhinopithecus bieti
            Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;
            Mammalia; Eutheria; Euarchontoglires; Primates; Haplorrhini;
            Catarrhini; Cercopithecidae; Colobinae; Rhinopithecus.
COMMENT     MODEL REFSEQ:  This record is predicted by automated computational
            analysis. This record is derived from a genomic sequence
            (NW_016826299.1) annotated using gene prediction method: Gnomon,
            supported by mRNA and EST evidence.
            Also see:
                Documentation of NCBI's Annotation Process
            
            ##Genome-Annotation-Data-START##
            Annotation Provider         :: NCBI
            Annotation Status           :: Full annotation
            Annotation Version          :: Rhinopithecus bieti Annotation
                                           Release 100
            Annotation Pipeline         :: NCBI eukaryotic genome annotation
                                           pipeline
            Annotation Software Version :: 7.1
            Annotation Method           :: Best-placed RefSeq; Gnomon
            Features Annotated          :: Gene; mRNA; CDS; ncRNA
            ##Genome-Annotation-Data-END##
FEATURES             Location/Qualifiers
     source          1..1253
                     /organism="Rhinopithecus bieti"
                     /mol_type="mRNA"
                     /isolate="Rb0"
                     /db_xref="taxon:61621"
                     /chromosome="Unknown"
                     /sex="male"
                     /tissue_type="blood"
     gene            1..1253
                     /gene="VIMP"
                     /note="Derived by automated computational analysis using
                     gene prediction method: Gnomon. Supporting evidence
                     includes similarity to: 5 mRNAs, 222 ESTs, 11 Proteins,
                     and 100% coverage of the annotated genomic feature by
                     RNAseq alignments, including 12 samples with support for
                     all annotated introns"
                     /db_xref="GeneID:108522926"
     CDS             92..658
                     /gene="VIMP"
                     /codon_start=1
                     /product="selenoprotein S isoform X2"
                     /protein_id="XP_017718874.1"
                     /db_xref="GeneID:108522926"
                     /translation="
MERQEDSLSARPALETEGLRFLHVTVGSLLASYGWYIVFSCILLYVVFQKLSARLRALRQRQLDRAAASVEPDVVVKRQEALAAARLKMQEELNAQVEKHKEKLKQLEEEKRRQKIEMWDSMQEGKSYKGNAKKPQEEDSAGPSTSSVVVKRKSDRKPLRGGGYNPLSGEGGGTCSWRPGRRGPSSGG"
     misc_feature    92..655
                     /gene="VIMP"
                     /note="Selenoprotein S (SelS); Region: Selenoprotein_S;
                     pfam06936"
                     /db_xref="CDD:462043"
ORIGIN      
gaccgcgtccgggcgcgccacgtgtgcgtgggagcgcaccggaagcgtccggctggaggcgcggcggccggcctgggcggcggtggccgtcatggagcggcaagaggattccctgtccgcgcggccggccctggagaccgagggactgcgcttcctgcacgtcacggtgggctctttgctggccagctatggctggtacatcgtcttcagctgcatccttctctacgtggtctttcagaagctttccgcccggctgagagccttgaggcagaggcagctggaccgagctgcggcttccgtggaacctgatgttgttgttaaacgacaagaagctttagcagctgctcgattgaaaatgcaagaagaattaaatgcgcaagttgaaaagcataaggaaaaactgaaacagcttgaagaagaaaaaaggagacagaagattgaaatgtgggacagcatgcaagaaggaaaaagttacaaaggaaacgcaaagaagcctcaggaggaagacagtgctgggccttccacttcatctgtcgtcgtgaaacggaaatcggacagaaaaccgttgcggggaggtggttataaccctttgtctggtgaaggaggtggaacctgctcctggagacctggacgcagaggtccgtcatctggcggatgaggctaaaaatcttgttagtgtcgcttttgacattagcaagatgaatccttaaccctcgattcaattgccttacgcacgcttttcacagtgactagccaaggggaggtggggttgatttctgttcctaactacacctgcatatgtcagggctccagtcagcaaaaggtatagatgttgcctctaggcattaggtcattagtcacattccacttggagacagtgattgcattcattgatttcatggttaattgctagttggtaggtaaaggcctctagatgatgagcagtcttgataaaagaggcctagtaatgttcttttgaaattagaaatccttgctgctaggacagtctctgtgacaggttgcgttgaatgatgtcttccttatcaatggtgagcccaccagtgaggattactgatgtggacagttgatggggtttgtttctgtatatttatttttatgtatagaactttgtaaaacaaaactatttaaaaaacgagaataacatttttagcatctttattcaaggagatttatggacttgaatttgtctatcaaacattaaatagctttttattactcacaacttccaacta
//

by @meso_cacase at DBCLS
This page is licensed under a Creative Commons Attribution 4.0 International License (CC BY 4.0).

If you use GGRNA in your work, please cite:
Naito Y, Bono H. (2012)
GGRNA: an ultrafast, transcript-oriented search engine for genes and transcripts.
Nucleic Acids Res., 40, W592-W596. [Full Text]